PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10012656
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 74aa    MW: 8419.96 Da    PI: 10.0553
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10012656genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF38.21.9e-127441350
                 HHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF 13 fskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 + k r ++ KKA ELS+LC ++va + f ++g++ ++s
  Lus10012656  7 LKKTRRTLKKKAPELSTLCCIDVAYVCFEPNGEVDTWS 44
                 678899*******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500669.881147IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.53E-13261IPR002100Transcription factor, MADS-box
PfamPF003198.6E-11343IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
MSRSPQLKKT RRTLKKKAPE LSTLCCIDVA YVCFEPNGEV DTWSEDPNKV KDIILKYRHV  60
KSAIKYPLKL VPT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11016RRTLKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40120.13e-09AGAMOUS-like 76